You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358989 |
---|---|
Category | Proteins |
Description | Recombinant monkey IL3 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
MW | 14.0 kDa |
UniProt ID | P25140 |
Protein Sequence | APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Macaca mulatta (Rhesus macaque) |
Biological Activity | Assay #1: Fully biologically active when compared to standard. The ED50 as determined by the dose- dependent stimulation of the proliferation of murine NFS-60 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2 × 105 IU/mg. Assay #2: The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg. |
Expression Region | 20-143aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 5 % trehalose |
Alternative names | IL-3, Mast cell growth factor, MCGF, Multipotentia Read more... |
Background | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Monkey IL3 protein (Active)
Filter by Rating