You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325566 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MOGAT1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MOGAT1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | MOGAT1 |
UniProt ID | Q96PD6 |
Protein Sequence | Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK |
NCBI | NP_477513 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti-2-acylglycerol O-acyltransferase 1 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Liver tissue using MOGAT1 antibody
Host: Rabbit, Target Name: MOGAT1, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Liver.
ICC, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating