MMP9 Antibody

• Catalog Number: orb315176
• Category: Antibodies
• Description: MMP9 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 78458 MW
• UniProt ID: P14780
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Matrix metalloproteinase-9;MMP-9;3.4.24.35;92 kDa
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of MMP9 using anti-MMP9 antibody.Lane 1:human A549 cell.

IHC analysis of MMP9 using anti-MMP9 antibody. MMP9 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of MMP9 using anti-MMP9 antibody. MMP9 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of MMP9 using anti-MMP9 antibody. MMP9 was detected in a paraffin-embedded section of human lymphadenoma tissue.

IHC analysis of MMP9 using anti-MMP9 antibody. MMP9 was detected in a paraffin-embedded section of human lymph nodes of gastric adenocarcinoma rectal cancer tissue.

IHC analysis of MMP9 using anti-MMP9 antibody. MMP9 was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue.