You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578318 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MMP3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Equine, Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MMP3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43kDa |
Target | MMP3 |
UniProt ID | P08254 |
Protein Sequence | Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
NCBI | NP_002413 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SL-1, STMY, STR1, CHDS6, MMP-3, STMY1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Equine Cartilage Explants, Primary Dilution: 1:1000.
Application: IHC, Species+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancer, Primary antibody dilution: 1:100, Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP.
MMP3 antibody - middle region (orb578318) validated by WB using Equine Cartilage Explants at 1:1000.
WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating