MMP19 antibody

• Catalog Number: orb574132
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP19
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP19
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: MMP19
• UniProt ID: Q99542
• Protein Sequence: Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
• NCBI: NP_002420
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CODA, MMP18, RASI-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

Human urinary bladder

Sample Type: Control-Human small intestine, Sample-Human colorectal cancer, Primary Antibody dilution: 1:100, Secondary Antibody: Biotinylated pig anti-rabbit+streptavidin-HRP, Color/Signal Descriptions: MMP19: Brown DAPI:Blue, Gene Name: MMP19.

WB Suggested Anti-MMP19 Antibody Titration: 5.0-10.0 ug/ml, Positive Control: HepG2 cell lysate.