You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574131 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MMP19 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP19 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | MMP19 |
UniProt ID | Q99542 |
Protein Sequence | Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR |
NCBI | NP_002420 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CODA, MMP18, RASI-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human urinary bladder
Human urinary bladder
Sample Type: Control-Human small intestine, Sample-Human colorectal cancer, Primary Antibody dilution: 1:100, Secondary Antibody: Biotinylated pig anti-rabbit+streptavidin-HRP, Color/Signal Descriptions: MMP19: Brown DAPI:Blue, Gene Name: MMP19.
WB Suggested Anti-MMP19 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating