You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581005 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MMEL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MMEL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 89 kDa |
Target | MMEL1 |
UniProt ID | Q495T6 |
Protein Sequence | Synthetic peptide located within the following region: EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV |
NCBI | NP_258428 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NL1, NL2, SEP, NEP2, MMEL2, NEPII Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml for this antibody. Additional isoforms of ~70 kDa can be detected in some samples.
Host: Rabbit, Target: MMEL1, Positive control (+): MCF7 (N10), Negative control (-): NTERA2 (N27), Antibody concentration: 1 ug/ml.
WB Suggested Anti-MMEL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
ELISA, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating