MMEL1 Rabbit Polyclonal Antibody

• Catalog Number: orb581005
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMEL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMEL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 89 kDa
• Target: MMEL1
• UniProt ID: Q495T6
• Protein Sequence: Synthetic peptide located within the following region: EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
• NCBI: NP_258428
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NL1, NL2, SEP, NEP2, MMEL2, NEPII
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml for this antibody. Additional isoforms of ~70 kDa can be detected in some samples.

Positive control (+): MCF7 (N10), Negative control (-): NTERA2 (N27), Antibody concentration: 1 ug/ml.

WB Suggested Anti-MMEL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.