You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575688 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MLXIP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Mouse, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MLXIP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 101kDa |
Target | MLXIP |
UniProt ID | Q9HAP2 |
Protein Sequence | Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP |
NCBI | NP_055753 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MIR, MONDOA, bHLHe36 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: MLXIP, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MLXIP, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MLXIP, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MLXIP, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MLXIP, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MLXIP, Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/ml. MLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3.
Rabbit Anti-MLXIP Antibody, Catalog Number: orb575688, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. MLXIP is supported by BioGPS gene expression data to be expressed in PANC1.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating