You have no items in your shopping cart.
Cart summary
MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active)
Catalog Number: orb2815981
| Catalog Number | orb2815981 |
|---|---|
| Category | Proteins |
| Description | MIP-1 alpha/CCL3 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P10855. |
| Tag | Tag Free |
| MW | 7.9 kDa (Predicted) |
| UniProt ID | P10855 |
| Protein Sequence | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 24-92 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
