You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581401 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MICALL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Goat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 93kDa |
Target | MICALL1 |
UniProt ID | Q8N3F8 |
Protein Sequence | Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP |
NCBI | NP_203744 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MIRAB13, MICAL-L1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: MICALL1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T.
Host: Rabbit, Target Name: MICALL1, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. MICALL1 is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target: MICALL1, Positive control (+): Human Placenta (PL), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 0.5 ug/ml.
Rabbit Anti-MICALL1 Antibody, Catalog Number: orb581401, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Filter by Rating