You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325948 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Mfsd7b |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60 kDa |
Target | FLVCR1 |
UniProt ID | B2RXV4 |
Protein Sequence | Synthetic peptide located within the following region: GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT |
NCBI | NP_001074728 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 9630055N22Rik antibody, anti FLVCR antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.
WB Suggested Anti-Mfsd7b Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Brain.
Filter by Rating