You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325479 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MFF |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33 |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | MFF |
UniProt ID | Q9GZY8 |
Protein Sequence | Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW |
NCBI | NP_064579 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp666J168 antibody, anti GL004 antibody, a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: MFF, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target Name: MFF, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: MFF, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target: MFF, Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.
WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating