You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578092 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MFAP4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | MFAP4 |
UniProt ID | P55083 |
Protein Sequence | Synthetic peptide located within the following region: TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK |
NCBI | NP_002395 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is processed to ~26 kDa.
Host: Rabbit, Target Name: MFAP4, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target: MFAP4, Positive control (+): Human Lung (LU), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/ml.
Rabbit Anti-MFAP4 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Lung, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Sample Type: Mouse sciatic nerve, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated Anti-Rabbit 1:1000 followed by avidin-biotin and diaminobenzidine, Secondary Antibody Dilution: 1:1000, Gene Name: MFAP4.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-MFAP4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.
Filter by Rating