You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587187 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MEX3A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human MEX3A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | MEX3A |
UniProt ID | A1L020 |
Protein Sequence | Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP |
NCBI | NP_001087194 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RKHD4, MEX-3A, RNF162 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: MEX3A, Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: MEX3A, Positive control (+): Human Brain (BR), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating