Cart summary

You have no items in your shopping cart.

    METTL3 Antibody

    Catalog Number: orb692197

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb692197
    CategoryAntibodies
    DescriptionMETTL3 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, FC, ICC, IF, IHC, WB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human METTL3 (HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW75 kDa
    UniProt IDQ86U44
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesN6-adenosine-methyltransferase catalytic subunit
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
    Expiration Date12 months from date of receipt.
    METTL3 Antibody

    IHC analysis of METTL3 using anti-METTL3 antibody (orb692197). METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (orb692197) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    METTL3 Antibody

    IHC analysis of METTL3 using anti-METTL3 antibody (orb692197). METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (orb692197) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    METTL3 Antibody

    IHC analysis of METTL3 using anti-METTL3 antibody (orb692197). METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (orb692197) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    METTL3 Antibody

    IF analysis of METTL3 using anti-METTL3 antibody (orb692197). METTL3 was detected in immunocytochemical section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-METTL3 Antibody (orb692197) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

    METTL3 Antibody

    Western blot analysis of METTL3 using anti-METTL3 antibody (orb692197). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human PC-3 whole cell lysates, Lane 2: human HEPG2 whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: human HEK293 whole cell lysates, Lane 5: human HELA whole cell lysates, Lane 6: human CACO-2 whole cell lysates, Lane 7: human K562 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-METTL3 antigen affinity purified polyclonal antibody (Catalog # orb692197) at 0.25 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for METTL3 at approximately 75KD. The expected band size for METTL3 is at 75KD.

    METTL3 Antibody

    Flow Cytometry analysis of THP-1 cells using anti-METTL3 antibody (orb692197). Overlay histogram showing THP-1 cells stained with orb692197 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-METTL3 Antibody (orb692197, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    METTL3 Antibody

    IHC analysis of METTL3 using anti-METTL3 antibody (orb692197). METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (orb692197) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    • METTL3 antibody [orb374082]

      ELISA,  IF,  IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl, 200 μl, 50 μl
    • METTL3 Antibody [orb692196]

      ELISA,  FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • METTL3 Antibody [orb1255879]

      IF,  IHC,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • METTL3 antibody [orb341486]

      IF,  IH,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • METTL3/MT-A70 Antibody [orb1528165]

      IP,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      2 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars