You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693479 |
---|---|
Category | Proteins |
Description | Melanostatin, frog is an inhibitor for α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM. |
CAS Number | 134709-16-3 |
Purity | ≥95% |
MW | 4243.76 |
Formula | C189H285N53O57S |
Target | Melanocortin Receptor |
Protein Sequence | YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |