MEIS2 monoclonal antibody (M01), clone 1H4

• Catalog Number: orb2292602
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MEIS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: MEIS2 (AAH01516, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
• NCBI: AAH01516
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MEIS2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MEIS2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to MEIS2 on formalin-fixed paraffin-embedded human spleen tissue. [antibody concentration 1 ug/ml]

MEIS2 monoclonal antibody (M01), clone 1H4 Western Blot analysis of MEIS2 expression in HeLa.

MEIS2 monoclonal antibody (M01), clone 1H4. Western Blot analysis of MEIS2 expression in K-562.

Western Blot analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody (M01), clone 1H4. Lane 1: MEIS2 transfected lysate (51.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (67.65 KDa).