MED4 antibody

• Catalog Number: orb581126
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MED4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: MED4
• UniProt ID: Q9NPJ6
• Protein Sequence: Synthetic peptide located within the following region: EEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPST
• NCBI: NP_054885
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARC36, VDRIP, DRIP36, TRAP36, HSPC126
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Testis

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-MED4 antibody (orb581126).

WB Suggested Anti-MED4 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.