Med21 antibody

• Catalog Number: orb575597
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Med21
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rat, Zebrafish
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 15kDa
• Target: Med21
• UniProt ID: Q9CQ39
• Protein Sequence: Synthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD
• NCBI: NP_079591
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Sr, Sur, Srb7, Surb7, D19234, AI449604, D6Ertd782,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-Med21 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.