MDR1 antibody

• Catalog Number: orb581349
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MDR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABCB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 141kDa
• Target: ABCB1
• UniProt ID: P08183
• Protein Sequence: Synthetic peptide located within the following region: AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
• NCBI: NP_000918
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CLCS, MDR1, P-GP, PGY1, ABC20, CD243, GP170, p-170
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: ABCB1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: ABCB1, Sample Tissue: Human K562 Whole Cell, Antibody dilution: 5 ug/ml.

Host: Rabbit, Target Name: ABCB1, Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: ABCB1, Positive control (+): Rat Liver (R-LI), Negative control (-): Rat Testis (R-TE), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Adrenal tissue.

Immunohistochemistry with Human Placenta tissue.

WB Suggested Anti-ABCB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate.