MCOLN1 antibody

• Catalog Number: orb575440
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MCOLN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MCOLN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64 kDa
• Target: MCOLN1
• UniProt ID: Q9GZU1
• Protein Sequence: Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
• NCBI: NP_065394
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ML1, ML4, MG-2, MLIV, MST080, TRPML1, MSTP080, TRP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. MCOLN1 can be glycosylated among other modifications.

Host: Rabbit, Target Name: MCOLN1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: MCOLN1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: MCOLN1, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: MCOLN1, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: MCOLN1, Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-MCOLN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.