MCM9 antibody

• Catalog Number: orb576056
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MCM9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MCM9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: MCM9
• UniProt ID: B3KV41
• Protein Sequence: Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
• NCBI: NP_694987
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ODG4, MCMDC1, C6orf61, dJ329L24.1, dJ329L24.3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MCM9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. MCM9 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-MCM9 antibody Titration: 1 ug/ml, Sample Type: Human liver.