You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576056 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MCM9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MCM9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44kDa |
Target | MCM9 |
UniProt ID | B3KV41 |
Protein Sequence | Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN |
NCBI | NP_694987 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ODG4, MCMDC1, C6orf61, dJ329L24.1, dJ329L24.3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-MCM9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. MCM9 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-MCM9 antibody Titration: 1 ug/ml, Sample Type: Human liver.
Filter by Rating