MCCC2 Peptide - C-terminal region

• Catalog Number: orb1999792
• Category: Proteins
• Description: MCCC2 Peptide - C-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• MW: 57 kDa
• UniProt ID: Q9HCC0
• Protein Sequence: Synthetic peptide located within the following region: QFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSF
• NCBI: NP_071415.1
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Buffer/Preservatives: Lyophilized powder
• Alternative names: MCCB
• Note: For research use only
• Expiration Date: 6 months from date of receipt.