You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1999792 |
---|---|
Category | Proteins |
Description | MCCC2 Peptide - C-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 57 kDa |
UniProt ID | Q9HCC0 |
Protein Sequence | Synthetic peptide located within the following region: QFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSF |
NCBI | NP_071415.1 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | MCCB Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating