Cart summary

You have no items in your shopping cart.

    MC2 receptor/MC2R Antibody

    Catalog Number: orb389494

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb389494
    CategoryAntibodies
    DescriptionMC2 receptor/MC2R Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman, Mouse
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW33927 MW
    UniProt IDQ01718
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesAdrenocorticotropic hormone receptor;ACTH receptor
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    MC2 receptor/MC2R Antibody

    WB analysis of MC2 receptor using anti-MC2 receptor antibody.Lane 1:mouse brain tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars