You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb669188 |
---|---|
Category | Antibodies |
Description | MBD1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human MBD1 (DLTLFDFKQGILCYPAPKAHPVAVASKKRK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 67 kDa |
UniProt ID | Q9UIS9 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MBD1 using anti-MBD1 antibody (orb669188). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates, Lane 2: human HELA whole cell lysates, Lane 3: human HEK293 whole cell lysates, Lane 4: human HEPG2 whole cell lysates, Lane 5: human U20S whole cell lysates, Lane 6: rat thymus tissue lysates, Lane 7: mouse thymus tissue lysates, Lane 8: mouse SP2/0 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MBD1 antigen affinity purified polyclonal antibody (Catalog # orb669188) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for MBD1 at approximately 67KD. The expected band size for MBD1 is at 67KD.
Flow Cytometry analysis of A549 cells using anti-MBD1 antibody (orb669188). Overlay histogram showing A549 cells stained with orb669188 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (orb669188, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U20S cells using anti-MBD1 antibody (orb669188). Overlay histogram showing U20S cells stained with orb669188 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (orb669188, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
FC, IH, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating