MAX antibody

• Catalog Number: orb329964
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAX
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAX
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: MAX
• UniProt ID: P61244
• Protein Sequence: Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
• NCBI: NP_002373
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti orf1 antibody, anti bHLHd4 antibody, anti bHL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using MAX antibody

Host: Mouse, Target Name: MAX, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-MAX Antibody, Catalog Number: orb329964, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-MAX Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.