You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577832 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MATR3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MATR3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 93kDa |
Target | MATR3 |
UniProt ID | P43243 |
Protein Sequence | Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA |
NCBI | NP_061322 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MPD2, ALS21, VCPDM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-MATR3 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-MATR3 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-MATR3 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-MATR3 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. MATR3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating