You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb388427 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody to MAP3K1 |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F6 |
Tested applications | IHC-P, WB |
Reactivity | Human |
Isotype | Mouse / IgG2a, kappa |
Immunogen | Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
Concentration | Purified Ab with BSA and Azide at 200ug/ml |
Dilution range | FACS: 0.5-1 μg/million cells, IF/ICC: 1-2 μg/ml, WB: 0.5-1 μg/ml, IHC-P: 0.5-1 μg/ml |
Conjugation | Unconjugated |
MW | 195kDa (intact); 80kDa (cleaved) |
Target | MAP3K1 |
Entrez | 4214 |
UniProt ID | Q13233 |
Storage | Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required. |
Buffer/Preservatives | 200ug/ml of Ab Purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml. |
Alternative names | MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1 Read more... |
Note | For research use only |
Application notes | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Uterine Carcinoma tissue using MAP3K1 antibody
Immunohistochemical staining of human Thyroid Carcinoma tissue using MAP3K1 antibody
Immunohistochemical staining of human Cervical Carcinoma tissue using MAP3K1 antibody
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating