You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216253 |
---|---|
Category | Proteins |
Description | The Dolphin IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Dolphin IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Dolphin IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Dolphin IFN gamma Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYCQAPFFKE IQNLKEYFNA SNPDVAGGGP LFLEILENWK DESDKKIIQS QIVSFYFKLF ENLKGNQIIQ RSMDIIKQDM FQKFLNGSSE KLDDFKKLIQ IPVDDLQIQR KAISELIRVM KDLSPRSNLR KRRRSQNLFR GQRASK (146)) (Gene ID: 101337436). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 17.2 kDa |
Target | IFN gamma |
Entrez | 101337436 |
Protein Sequence | SYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLEILENWKDESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQIPVDDLQIQRKAISELIRVMKDLSPRSNLRKRRRSQNLFRGQRASK (146) |
Protein Length | 146 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating