MAFA antibody

• Catalog Number: orb580207
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAFA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAFA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: MAFA
• UniProt ID: Q8NHW3
• Protein Sequence: Synthetic peptide located within the following region: PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS
• NCBI: NP_963883
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: INSDM, hMafA, RIPE3b1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: MAFA, Sample Tissue: Human HCT116, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: MAFA, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: MAFA, Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

WB Suggested Anti-MAFA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.