MAF antibody

• Catalog Number: orb576760
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAF
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: MAF
• UniProt ID: O75444
• Protein Sequence: Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI
• NCBI: NP_001026974
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CCA4, AYGRP, c-MAF, CTRCT21
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

WB Suggested Anti-MAF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.