LZTR1 antibody

• Catalog Number: orb576863
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LZTR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LZTR1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95kDa
• Target: LZTR1
• UniProt ID: Q8N653
• Protein Sequence: Synthetic peptide located within the following region: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ
• NCBI: NP_006758
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NS2, NS10, BTBD29, LZTR-1, SWNTS2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: LZTR1, Positive control (+): 293T Cell Lysate (2T), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 5 ug/ml.

WB Suggested Anti-LZTR1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.