Lysozyme/LYZ Antibody

• Catalog Number: orb315171
• Category: Antibodies
• Description: Lysozyme/LYZ Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 16537 MW
• UniProt ID: P61626
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Lysozyme C;3.2.1.17;1,4-beta-N-acetylmuramidase C;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Lysozyme using anti-Lysozyme antibody.Lane 1:Rat Intestine Tissue;2:Rat Kidney Tissue;3:Rat Liver Tissue;4:HELA Cell;5:SW620 Cell;6:293T Cell;7:HEPG2 Cell.

IF analysis of Lysozyme using anti-Lysozyme antibody.Lysozyme was detected in paraffin-embedded section of human ileum tissue.

IF analysis of Lysozyme using anti-Lysozyme antibody.Lysozyme was detected in paraffin-embedded section of human colon organoid tissue.

IF analysis of Lysozyme using anti-Lysozyme antibody.Lysozyme was detected in paraffin-embedded section of mouse ileum tissue.

IF analysis of Lysozyme using anti-Lysozyme antibody.Lysozyme was detected in paraffin-embedded section of mouse ileum organoid tissue.

IHC analysis of Lysozyme using anti-Lysozyme antibody. Lysozyme was detected in a paraffin-embedded section of human intestinal cancer tissue.