You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402462 |
---|---|
Category | Antibodies |
Description | Lyn Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 58574 MW |
UniProt ID | P07948 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tyrosine-protein kinase Lyn;2.7.10.2;Lck/Yes-relat Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Lyn using anti-Lyn antibody.Lane 1:human 293T Cell.
IHC analysis of Lyn using anti-Lyn antibody.Lyn was detected in paraffin-embedded section of mouse intestine tissue.
IHC analysis of Lyn using anti-Lyn antibody.Lyn was detected in paraffin-embedded section of rat spleen tissue.
IHC analysis of Lyn using anti-Lyn antibody.Lyn was detected in paraffin-embedded section of human tonsil tissue.
IHC analysis of Lyn using anti-Lyn antibody.Lyn was detected in paraffin-embedded section of mouse spleen tissue.
IHC analysis of Lyn using anti-Lyn antibody.Lyn was detected in paraffin-embedded section of rat lymphaden tissue.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating