LYN antibody

• Catalog Number: orb330772
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LYN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: LYN
• UniProt ID: P07948
• Protein Sequence: Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
• NCBI: NP_002341
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ26625 antibody, anti JTK8 antibody, anti p
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Lung tissue using LYN antibody

Western blot analysis of Hela cell lysate tissue using LYN antibody

Western blot analysis of human Fetal Brain tissue using LYN antibody

Western blot analysis of human Fetal Heart tissue using LYN antibody

Host: Mouse, Target Name: LYN, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: LYN, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: LYN, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: LYN, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: LYN, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-LYN Antibody, Catalog Number: orb330772, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, LYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.