Cart summary

You have no items in your shopping cart.

    LRTOMT Antibody

    Catalog Number: orb570395

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb570395
    CategoryAntibodies
    DescriptionLRTOMT Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW28 kDa
    UniProt IDQ8WZ04
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesTransmembrane O-methyltransferase; Catechol O-meth
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    LRTOMT Antibody

    IHC analysis of LRTOMT using anti-LRTOMT antibody (orb570395). LRTOMT was detected in paraffin-embedded section of human placenta tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-LRTOMT Antibody (orb570395) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    LRTOMT Antibody

    IHC analysis of LRTOMT using anti-LRTOMT antibody (orb570395). LRTOMT was detected in paraffin-embedded section of human Lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-LRTOMT Antibody (orb570395) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    LRTOMT Antibody

    IHC analysis of LRTOMT using anti-LRTOMT antibody (orb570395). LRTOMT was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-LRTOMT Antibody (orb570395) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    LRTOMT Antibody

    IHC analysis of LRTOMT using anti-LRTOMT antibody (orb570395). LRTOMT was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-LRTOMT Antibody (orb570395) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    LRTOMT Antibody

    IHC analysis of LRTOMT using anti-LRTOMT antibody (orb570395). LRTOMT was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-LRTOMT Antibody (orb570395) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    LRTOMT Antibody

    Western blot analysis of LRTOMT using anti-LRTOMT antibody (orb570395). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates, Lane 2: human MCF-7 whole cell lysates, Lane 3: human HeLa whole cell lysates, Lane 4: human Caco-2 whole cell lysates, Lane 5: human K562 whole cell lysates, Lane 6: human U20S whole cell lysates, Lane 7: human THP-1 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LRTOMT antigen affinity purified polyclonal antibody (Catalog # orb570395) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for LRTOMT at approximately 28KD. The expected band size for LRTOMT is at 28KD.

    LRTOMT Antibody

    Western blot analysis of LRTOMT using anti-LRTOMT antibody (orb570395). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysates, Lane 2: rat ovarian tissue lysates, Lane 3: rat heart tissue lysates, Lane 4: rat lung tissue lysates, Lane 5: mouse brain tissue lysates, Lane 6: mouse lung tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LRTOMT antigen affinity purified polyclonal antibody (Catalog # orb570395) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for LRTOMT at approximately 28KD. The expected band size for LRTOMT is at 28KD.

    • Anti-LRTOMT Antibody [orb1879683]

      WB

      Human

      Polyclonal

      Unconjugated

      50 μl, 100 μl, 200 μl
    • LRTOMT Antibody [orb1244376]

      ELISA,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • LRTOMT antibody [orb306405]

      WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      80 μl
    • LRTOMT antibody [orb704195]

      WB

      Canine, Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • LRTOMT antibody [orb325995]

      WB

      Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars