You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584197 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LRRFIP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LRRFIP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | LRRFIP1 |
UniProt ID | E9PGZ2 |
Protein Sequence | Synthetic peptide located within the following region: ERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIATNGETSDTLN |
NCBI | NP_001131022 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GCF2, TRIP, FLAP1, GCF-2, FLAP-1, HUFI-1, FLIIAP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LRRFIP1, Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml. LRRFIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
WB Suggested Anti-LRRFIP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: U937 cell lysate.
ELISA, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating