You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580695 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LRRC59 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LRRC59 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | LRRC59 |
UniProt ID | Q96AG4 |
Protein Sequence | Synthetic peptide located within the following region: KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL |
NCBI | NP_060979 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p34, PRO1855 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LRRC59, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-LRRC59 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate. LRRC59 is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating