You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326508 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LPAR4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | LPAR4 |
UniProt ID | Q99677 |
Protein Sequence | Synthetic peptide located within the following region: SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF |
NCBI | NP_005287 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti GPR23 antibody, anti LPA4 antibody, anti P2RY Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LPAR4, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-LPAR4 Antibody, Titration: 1.0 ug/mL, Positive Control: RPMI-8226 Whole Cell, LPAR4 is supported by BioGPS gene expression data to be expressed in RPMI 8226.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating