You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb312112 |
---|---|
Category | Antibodies |
Description | liver FABP/FABP1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Gallus, Human, Monkey, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 14208 MW |
UniProt ID | P07148 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Fatty acid-binding protein, liver;Fatty acid-bindi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of liver FABP using anti-liver FABP antibody.Lane 1:Rat Liver Tissue;2:Mouse Liver Tissue;3:SMMC Cell;4:HEPG2 Cell;5:RH35 Cell.
WB analysis of liver FABP using anti-liver FABP antibody.Lane 1:rat liver tissue; 2:rat kidney tissue; 3:rat RH35 cell; 4:mouse liver tissue; 5:mouse kidney tissue.
IHC analysis of liver FABP using anti-liver FABP antibody. liver FABP was detected in a paraffin-embedded section of mouse intestine tissue.
IHC analysis of liver FABP using anti-liver FABP antibody. liver FABP was detected in a paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of liver FABP using anti-liver FABP antibody. liver FABP was detected in a paraffin-embedded section of rat intestine tissue.
Filter by Rating