You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585391 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LIMCH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Mouse, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 121kDa |
Target | LIMCH1 |
UniProt ID | Q9UPQ0 |
Protein Sequence | Synthetic peptide located within the following region: EDVKPKTLPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSP |
NCBI | NP_055803 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LMO7B, LIMCH1A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LIMCH1, Antibody dilution: 1.0 ug/ml, Sample Type: THP-1 cell lysate.
Filter by Rating