You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585807 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LILRB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 65 kDa |
Target | LILRB2 |
UniProt ID | Q8N423 |
Protein Sequence | Synthetic peptide located within the following region: MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA |
NCBI | NP_005865 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ILT4, LIR2, CD85D, ILT-4, LIR-2, MIR10, MIR-10 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes Isoform 1 and Isoform 4 (52 kDa) in some samples.
Host: Rabbit, Target Name: LILRB2, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: LILRB2, Positive control (+): Human brain (BR), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-LILRB2 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
Filter by Rating