You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585876 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LGALS7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC |
Predicted Reactivity | Bovine, Canine, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 15 kDa |
Target | LGALS7 |
UniProt ID | P47929 |
Protein Sequence | Synthetic peptide located within the following region: SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP |
NCBI | NP_002298 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GAL7, LGALS7A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-LGALS7 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-LGALS7 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thymus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating