LGALS7 antibody

• Catalog Number: orb585876
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LGALS7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Predicted Reactivity: Bovine, Canine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 15 kDa
• Target: LGALS7
• UniProt ID: P47929
• Protein Sequence: Synthetic peptide located within the following region: SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
• NCBI: NP_002298
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GAL7, LGALS7A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-LGALS7 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-LGALS7 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thymus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.