You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb412983 |
---|---|
Category | Antibodies |
Description | LGALS3BP Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 75 kDa |
UniProt ID | Q08380 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Galectin-3-binding protein; Basement membrane auto Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of LGALS3BP using anti-LGALS3BP antibody.Lane 1:human HeLa cell;2:human COLO-320 cell;3:mouse HEPA1-6 cell.
IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of mouse small intestine tissue.
IHC analysis of LGALS3BP using anti-LGALS3BP antibody.LGALS3BP was detected in paraffin-embedded section of human lung cancer tissue.
ICC, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating