You have no items in your shopping cart.
Cart summary
Levanase Protein, Bacillus subtilis, Recombinant (His)
Catalog Number: orb1979742
| Catalog Number | orb1979742 |
|---|---|
| Category | Proteins |
| Description | Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free fructose. Is also able to hydrolyze sucrose and to a small extent raffinose, but not melezitose, stachylose, cellobiose, maltose, and lactose. Levanase Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 77.2 kDa and the accession number is P05656. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 77.2 kDa (predicted) |
| UniProt ID | P05656 |
| Protein Sequence | ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES |
| Expression System | E. coli |
| Biological Origin | Bacillus subtilis |
| Biological Activity | Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free fructose. Is also able to hydrolyze sucrose and to a small extent raffinose, but not melezitose, stachylose, cellobiose, maltose, and lactose. Levanase Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 77.2 kDa and the accession number is P05656. |
| Expression Region | 25-677 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
