You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693734 |
---|---|
Category | Proteins |
Description | The native and reduced forms of LEAP-2 have similar antimicrobial activities which suggests that the disulfide bridges are not essential for activity. |
Purity | ≥95% |
MW | 4585.36 |
Formula | C191H320N64O57S5 |
Target | others |
Protein Sequence | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAEQ |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |