You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292663 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human LDHA protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Reactivity | Human |
Immunogen | LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
NCBI | NP_005557.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of LDHA transfected lysate using anti-LDHA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHA MaxPab mouse polyclonal antibody (B01).
LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.
Western Blot analysis of LDHA expression in transfected 293T cell line by LDHA MaxPab polyclonal antibody. Lane 1: LDHA transfected lysate (36.70 KDa). Lane 2: Non-transfected lysate.