LDHA Rabbit Polyclonal Antibody

• Catalog Number: orb582474
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LDHA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: LDHA
• UniProt ID: P00338
• Protein Sequence: Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
• NCBI: NP_005557
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LDHM, GSD11, PIG19, HEL-S-133P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat, MCF7, 721_B, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. LDHA is supported by BioGPS gene expression data to be expressed in HeLa.

LDHA was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582474 with 1:200 dilution. Western blot was performed using orb582474 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHA IP with orb582474 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-LDHA Antibody, Catalog Number: orb582474, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.