You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582474 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LDHA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LDHA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | LDHA |
UniProt ID | P00338 |
Protein Sequence | Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH |
NCBI | NP_005557 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LDHM, GSD11, PIG19, HEL-S-133P Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LDHA, Sample Tissue: Human Jurkat, MCF7, 721_B, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: LDHA, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. LDHA is supported by BioGPS gene expression data to be expressed in HeLa.
LDHA was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582474 with 1:200 dilution. Western blot was performed using orb582474 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHA IP with orb582474 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Rabbit Anti-LDHA Antibody, Catalog Number: orb582474, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Bovine, Monkey, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating