You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334540 |
---|---|
Category | Antibodies |
Description | Lck Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 58001 MW |
UniProt ID | P06239 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tyrosine-protein kinase Lck;2.7.10.2;Leukocyte C-t Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HepG2 cells using anti-Lck antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Lck using anti-Lck antibody.Lane 1:human Jurkat cell; 2:mouse spleen tissue; 3:mouse thymus tissue.
IF analysis of Lck using anti-Lck antibody. Lck was detected in immunocytochemical section of U20S cells.
IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of mouse lymphaden tissue.
IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of rat lymphaden tissue.
IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of human tonsil tissue.
IHC analysis of Lck using anti-Lck antibody. Lck was detected in frozen section of mouse spleen tissue.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating