LAS1L antibody

• Catalog Number: orb324568
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LAS1L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAS1L
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83kDa
• Target: LAS1L
• UniProt ID: Q9Y4W2
• Protein Sequence: Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
• NCBI: NP_112483
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Las1-like antibody, anti dJ475B7.2 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 Whole Cell tissue using LAS1L antibody

Western blot analysis of human MCF7 tissue using LAS1L antibody

Western blot analysis of human HT1080 tissue using LAS1L antibody

Host: Rabbit, Target Name: LAS1L, Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

Host: Rabbit, Target Name: LAS1L, Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-LAS1L Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.